PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi006326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 589aa    MW: 64023.9 Da    PI: 5.7318
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S50073741PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32295349155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k+rlrWtpeLHerF+eav++L G+ekAtPk +l+lm+v+gLt++hvkSHLQkYR+
  Psi006326 295 KQRLRWTPELHERFIEAVKKLHGAEKATPKGVLKLMNVEGLTIYHVKSHLQKYRI 349
                79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.907292352IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-30293350IPR009057Homeodomain-like
SuperFamilySSF466891.31E-17293349IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-24295350IPR006447Myb domain, plants
PfamPF002494.2E-9297348IPR001005SANT/Myb domain
PfamPF143791.0E-22388435IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MSSQKADRLW HGESAIEPHH AVQAVSTTIA SQISNTSKSE GPTFAKDNSS FQRLVPQAVS  60
SDSPEPVDSG QENPFPRFSL SSSSKKLNSS PMSSNIIPAL SNVVNPENIS STSSTFCTDL  120
HFSPSSISQH HPPGILPFLP HPSECSLRAS VMPPSQSAFS QSLFSGDYMK QSYGDTHTGD  180
PLQDIFNFPD VASECSQRNQ GATSSGIVGQ GHTEPDEWQD WPEQLPSDDD SLVANWTDLL  240
VVESGEDPGL NTIYPAAKLP TTGSISQLHQ GFCAPAGGNQ FASSSTSSGT GTSNKQRLRW  300
TPELHERFIE AVKKLHGAEK ATPKGVLKLM NVEGLTIYHV KSHLQKYRIA KYMPDQGEGK  360
TSCYAAGKED KKRNSSDDLP TLDLKAGMQI TEALRLQMEM QKKLHEQLEV QRALQLKIEE  420
HGKYLQKMFE EQQKTDSSFK SQSLSAPRSS NPFAAAGPLE QSSDVEEDGS RSFPAKRIET  480
VQNKDNSGRG TLLAVGARDK SLPVVVADNN SEVVADTEKT PPCGSGSIPD AEDGIKAPPA  540
KRIRSNPDNT CMDKLGPXID RLGIMNNQPL PEAVFETYIS TLSQQRNIL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LKH40.0B8LKH4_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.35e-68G2-like family protein